PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00461.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 310aa    MW: 35699.1 Da    PI: 6.8376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00461.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.2e-131462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd  l+ +++++G+g +W   ++++g +R++k+c++rw++yl
  Rsa1.0_00461.1_g00005.1 14 KGPWSPEEDAMLKFYIEKHGTGnNWIQLPHKIGIKRCGKSCRLRWLNYL 62
                             79*******************************55************97 PP

2Myb_DNA-binding35.91.7e-1169111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +T eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Rsa1.0_00461.1_g00005.1  69 GGFTNEEDYIICSLYITIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.396962IPR017930Myb domain
SuperFamilySSF466891.09E-2613109IPR009057Homeodomain-like
SMARTSM007171.6E-111364IPR001005SANT/Myb domain
PfamPF002499.2E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-231569IPR009057Homeodomain-like
CDDcd001673.39E-81662No hitNo description
PROSITE profilePS5129419.57863117IPR017930Myb domain
SMARTSM007171.7E-1067115IPR001005SANT/Myb domain
PfamPF002495.3E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2370118IPR009057Homeodomain-like
CDDcd001671.11E-671113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRAPCCDKT VVKKGPWSPE EDAMLKFYIE KHGTGNNWIQ LPHKIGIKRC GKSCRLRWLN  60
YLRPNLKHGG FTNEEDYIIC SLYITIGSRW SIIASQLPGR TDNDIKNYWN TRLKKKLISK  120
QGKAIHQQLS LRLEPETISK RSSFGQNQIL MIHDENSKPP LNQTLHNQKA DPSITSFAME  180
EKRMDVKDPV LELFSWEQNR VWFDIDHNAA SSSYHHHASP HLNSMTTTTS SSIGTNSSLQ  240
MSHYTINNND QGDQEMFFMA GFDNLQNELF DEIINNNTAE FEFRGTETLD NNCLGHEINS  300
FVDYPLKDNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1891830.0AC189183.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB001A20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589662.10.0PREDICTED: transcription factor RAX3
RefseqXP_013722975.10.0PREDICTED: transcription factor RAX3-like
TrEMBLA0A078C2N80.0A0A078C2N8_BRANA; BnaC01g01250D protein
TrEMBLA0A0D3A1650.0A0A0D3A165_BRAOL; Uncharacterized protein
STRINGBra011785.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.11e-143myb domain protein 87